General Information

  • ID:  hor006637
  • Uniprot ID:  P51918
  • Protein name:  Progonadoliberin-1
  • Gene name:  gnrh1
  • Organism:  Haplochromis burtoni (Burton's mouthbrooder) (Chromis burtoni)
  • Family:  GnRH family
  • Source:  Animal
  • Expression:  Synthesized in preoptic neurons and is transported to the pituitary in the preoptic-hypophyseal axons.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Haplochromis (genus), Haplochromini (tribe), Pseudocrenilabrinae (subfamily), African cichlids, Cichlidae (family), Cichliformes (order), Cichlomorphae (superorder), Ovalentaria, Percomorphaceae, Euacanthomorphacea, Acanthomorphata, Ctenosquamata, Eurypterygia, Neoteleostei, Euteleosteomorpha (cohort), Clupeocephala, Osteoglossocephalai, Teleostei (infraclass), Neopterygii (subclass), Actinopteri (class), Actinopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0005183 gonadotropin hormone-releasing hormone activity
  • GO BP:  GO:0007165 signal transduction
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space

Sequence Information

  • Sequence:  QHWSYGLSPGGKRDLDNFSDTLGNMVEEFPRVEAPCSVFGCAEESPFAKMYRVKGLLASVAERENGHRTFKK
  • Length:  72(23-94)
  • Propeptide:  MAAKILALWLLLAGTVFPQGCCQHWSYGLSPGGKRDLDNFSDTLGNMVEEFPRVEAPCSVFGCAEESPFAKMYRVKGLLASVAERENGHRTFKK
  • Signal peptide:  MAAKILALWLLLAGTVFPQGCC
  • Modification:  T1 Pyrrolidone carboxylic acid;T10 Glycine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Stimulates the secretion of gonadotropins. May be responsible for the regulation of the hypothalamic-pituitary-gonadal axis.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  gnrh2, gnrh3
  • Target Unid:   P37044, P45652
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P51918-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor006637_AF2.pdbhor006637_ESM.pdb

Physical Information

Mass: 934666 Formula: C356H545N101O107S4
Absent amino acids: I Common amino acids: EGS
pI: 7.41 Basic residues: 12
Polar residues: 22 Hydrophobic residues: 21
Hydrophobicity: -61.81 Boman Index: -15186
Half-Life / Aliphatic Index: 0.8 hour Aliphatic Index: 54.17
Instability Index: 3928.47 Extinction Coefficient cystines: 8605
Absorbance 280nm: 121.2

Literature

  • PubMed ID:  7667296
  • Title:  Three gonadotropin-releasing hormone genes in one organism suggest novel roles for an ancient peptide.
  • PubMed ID:  9843638
  • Title:  Ontogeny of gonadotropin-releasing hormone (GnRH) gene expression reveals a distinct origin for GnRH-containing neurons in the midbrain.
  • PubMed ID:  7644702
  • Title:  Primary struc