HORDB

ID: hor006637
Uniprot ID: P51918
Protein name: Progonadoliberin-1
Gene name: gnrh1
Organism: Haplochromis burtoni (Burton's mouthbrooder) (Chromis burtoni)
Family: GnRH family
Source: animal
Expression: Synthesized in preoptic neurons and is transported to the pituitary in the preoptic-hypophyseal axons.
Disease: NA
Comments: NA
Taxonomy: Haplochromis (genus), Haplochromini (tribe), Pseudocrenilabrinae (subfamily), African cichlids, Cichlidae (family), Cichliformes (order), Cichlomorphae (superorder), Ovalentaria, Percomorphaceae, Euacanthomorphacea, Acanthomorphata, Ctenosquamata, Eurypterygia, Neoteleostei, Euteleosteomorpha (cohort), Clupeocephala, Osteoglossocephalai, Teleostei (infraclass), Neopterygii (subclass), Actinopteri (class), Actinopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
GO MF: GO:0005179 hormone activity; GO:0005183 gonadotropin hormone-releasing hormone activity
GO BP: GO:0007165 signal transduction
GO CC: GO:0005576 extracellular region; GO:0005615 extracellular space

Sequence: QHWSYGLSPGGKRDLDNFSDTLGNMVEEFPRVEAPCSVFGCAEESPFAKMYRVKGLLASVAERENGHRTFKK
Length: 72
Propeptide: MAAKILALWLLLAGTVFPQGCCQHWSYGLSPGGKRDLDNFSDTLGNMVEEFPRVEAPCSVFGCAEESPFAKMYRVKGLLASVAERENGHRTFKK
Signal peptide: MAAKILALWLLLAGTVFPQGCC
Modification: T1 Pyrrolidone carboxylic acid;T10 Glycine amide
Glycosylation: NA
Mutagenesis: NA

Function: Stimulates the secretion of gonadotropins. May be responsible for the regulation of the hypothalamic-pituitary-gonadal axis.
Mechanism: NA
Cross BBB: NA
Target: gnrh2, gnrh3
Target Unid: P37044, P45652
IC50: NA
EC50: NA
ED50: NA
kd: NA
Half life: NA

Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)

hor006637_AF2.pdb

hor006637_ESM.pdb

Mass:	934666	Formula:	C356H545N101O107S4
Absent amino acids:	I	Common amino acids:	EGS
pI:	7.41	Basic residues:	12
Polar residues:	22	Hydrophobic residues:	21
Hydrophobicity:	-61.81	Boman Index:	-15186
Half-Life:	0.8 hour	Half-Life Yeast:	10 min
Half-Life E.Coli:	>10 hour	Aliphatic Index	54.17
Instability Index:	3928.47	Extinction Coefficient cystines:	8605
Absorbance 280nm:	121.2

PubMed ID: 7667296
Title: Three gonadotropin-releasing hormone genes in one organism suggest novel roles for an ancient peptide.
PubMed ID: 9843638
Title: Ontogeny of gonadotropin-releasing hormone (GnRH) gene expression reveals a distinct origin for GnRH-containing neurons in the midbrain.
PubMed ID: 7644702
Title: Primary structure of solitary form of gonadotropin-releasing hormone (GnRH) in cichlid pituitary; three forms of GnRH in brain of cichlid and pumpkinseed fish.